![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) |
![]() | Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) ![]() |
![]() | Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (5 species) |
![]() | Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [55242] (5 PDB entries) |
![]() | Domain d1ej7s_: 1ej7 S: [39617] Other proteins in same PDB: d1ej7l1, d1ej7l2 |
PDB Entry: 1ej7 (more details), 2.45 Å
SCOP Domain Sequences for d1ej7s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ej7s_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun} mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp egy
Timeline for d1ej7s_: