Class g: Small proteins [56992] (98 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
Protein automated matches [190700] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187840] (48 PDB entries) |
Domain d6w7oc1: 6w7o C:260-350 [396093] Other proteins in same PDB: d6w7oa_, d6w7ob_, d6w7oc2, d6w7od2 automated match to d3oz1a_ complexed with tl7, zn |
PDB Entry: 6w7o (more details), 2.17 Å
SCOPe Domain Sequences for d6w7oc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6w7oc1 g.52.1.1 (C:260-350) automated matches {Human (Homo sapiens) [TaxId: 9606]} sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg ddpwvehakwfprceflirmkgqefvdeiqg
Timeline for d6w7oc1:
View in 3D Domains from other chains: (mouse over for more information) d6w7oa_, d6w7ob_, d6w7od1, d6w7od2 |