SCOPe 2.07: Domain d6w7oc1: 6w7o C:260-350

Lineage for d6w7oc1 (6w7o C:260-350)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (48 PDB entries)

8. Domain d6w7oc1: 6w7o C:260-350 [396093]
   Other proteins in same PDB: d6w7oa_, d6w7ob_, d6w7oc2, d6w7od2
   automated match to d3oz1a_
   complexed with tl7, zn

Details for d6w7oc1

PDB Entry: 6w7o, 2.17 Å

PDB Description: ternary complex structure - btk ciap compound 17

PDB Compounds: (C:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d6w7oc1:

Sequence; same for both SEQRES and ATOM records:

>d6w7oc1 g.52.1.1 (C:260-350) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg
ddpwvehakwfprceflirmkgqefvdeiqg

Timeline for d6w7oc1:

• d6w7oc1 is new in SCOPe 2.07-stable
  
• d6w7oc1 appears in the current release, SCOPe 2.08