Lineage for d6w7oc1 (6w7o C:260-350)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038051Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038052Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 3038053Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 3038187Protein automated matches [190700] (1 species)
    not a true protein
  7. 3038188Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries)
  8. 3038213Domain d6w7oc1: 6w7o C:260-350 [396093]
    Other proteins in same PDB: d6w7oa_, d6w7ob_, d6w7oc2, d6w7od2
    automated match to d3oz1a_
    complexed with tl7, zn

Details for d6w7oc1

PDB Entry: 6w7o (more details), 2.17 Å

PDB Description: ternary complex structure - btk ciap compound 17
PDB Compounds: (C:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d6w7oc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6w7oc1 g.52.1.1 (C:260-350) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg
ddpwvehakwfprceflirmkgqefvdeiqg

SCOPe Domain Coordinates for d6w7oc1:

Click to download the PDB-style file with coordinates for d6w7oc1.
(The format of our PDB-style files is described here.)

Timeline for d6w7oc1: