SCOPe 2.08: Domain d6vjcb1: 6vjc B:2-362

Lineage for d6vjcb1 (6vjc B:2-362)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (46 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [236738] (6 PDB entries)

8. Domain d6vjcb1: 6vjc B:2-362 [396014]
   Other proteins in same PDB: d6vjca2, d6vjcb2
   automated match to d1yhla_
   complexed with 476, act, ca, ipr, peg; mutant

Details for d6vjcb1

PDB Entry: 6vjc, 1.8 Å

PDB Description: lmfpps mutant t164y in complex with 476a, ipp & ca

PDB Compounds: (B:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d6vjcb1:

Sequence; same for both SEQRES and ATOM records:

>d6vjcb1 a.128.1.0 (B:2-362) automated matches {Leishmania major [TaxId: 5664]}
ahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvaea
makdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvta
qvaindglillawatqmalhyfadrpflaevlrvfhdvdlttyigqlydvtsmvdsakld
akvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvamv
mgeyfqvqddvmdcftppeklgkigtdiedakcswlavtflttapaekvaefkanygstd
paavavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwsktykrq
k

Timeline for d6vjcb1:

• d6vjcb1 first appeared in SCOPe 2.07