SCOPe 2.07: Domain d6t6oa2: 6t6o A:174-313

Lineage for d6t6oa2 (6t6o A:174-313)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (33 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1148] [225878] (8 PDB entries)

8. Domain d6t6oa2: 6t6o A:174-313 [395716]
   Other proteins in same PDB: d6t6oa1
   automated match to d5ui2a2
   complexed with asn, cl, ech, gol, his; mutant

Details for d6t6oa2

PDB Entry: 6t6o, 1.4 Å

PDB Description: y201w mutant of the orange carotenoid protein from synechocystis at ph 4.6

PDB Compounds: (A:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d6t6oa2:

Sequence; same for both SEQRES and ATOM records:

>d6t6oa2 d.17.4.0 (A:174-313) automated matches {Synechocystis sp. [TaxId: 1148]}
epvvppqdtasrtkvsiegvtnatvlnwmdnlnandfdtlielftsdgalqppfqrpivg
kenvlrffreecqnlklipergvtepaedgftqikvtgkvqtpwfggnvgmniawrflln
pegkiffvaidllaspkell

Timeline for d6t6oa2:

• d6t6oa2 is new in SCOPe 2.07-stable
  
• d6t6oa2 appears in the current release, SCOPe 2.08