Lineage for d1qf6a3 (1qf6 A:63-241)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 330269Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (3 superfamilies)
    core:alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 330270Superfamily d.67.1: Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55186] (1 family) (S)
    putative editing domain; probable circular permutation of LuxS (d.185.1.2)
  5. 330271Family d.67.1.1: Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55187] (1 protein)
  6. 330272Protein Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55188] (1 species)
  7. 330273Species Escherichia coli [TaxId:562] [55189] (1 PDB entry)
  8. 330274Domain d1qf6a3: 1qf6 A:63-241 [39562]
    Other proteins in same PDB: d1qf6a1, d1qf6a2, d1qf6a4
    complexed with aet, amp, dhu, g7m, psu, zn

Details for d1qf6a3

PDB Entry: 1qf6 (more details), 2.9 Å

PDB Description: structure of e. coli threonyl-trna synthetase complexed with its cognate trna

SCOP Domain Sequences for d1qf6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qf6a3 d.67.1.1 (A:63-241) Threonyl-tRNA synthetase (ThrRS), second 'additional' domain {Escherichia coli}
kdeegleiirhscahllghaikqlwphtkmaigpvidngfyydvdldrtltqedvealek
rmhelaeknydvikkkvswhearetfanrgesykvsildeniahddkpglyfheeyvdmc
rgphvpnmrfchhfklmktagaywrgdsnnkmlqriygtawadkkalnaylqrleeaak

SCOP Domain Coordinates for d1qf6a3:

Click to download the PDB-style file with coordinates for d1qf6a3.
(The format of our PDB-style files is described here.)

Timeline for d1qf6a3: