SCOPe 2.08: Domain d1qf6a3: 1qf6 A:63-241

Lineage for d1qf6a3 (1qf6 A:63-241)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
   core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families)
   putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2)

5. Family d.67.1.1: Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55187] (1 protein)

6. Protein Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55188] (2 species)

7. Species Escherichia coli [TaxId:562] [55189] (5 PDB entries)
   Uniprot P0A8M3

8. Domain d1qf6a3: 1qf6 A:63-241 [39562]
   Other proteins in same PDB: d1qf6a1, d1qf6a2, d1qf6a4
   protein/RNA complex; complexed with amp, zn

Details for d1qf6a3

PDB Entry: 1qf6, 2.9 Å

PDB Description: structure of e. coli threonyl-trna synthetase complexed with its cognate trna

PDB Compounds: (A:) threonyl-tRNA synthetase

SCOPe Domain Sequences for d1qf6a3:

Sequence; same for both SEQRES and ATOM records:

>d1qf6a3 d.67.1.1 (A:63-241) Threonyl-tRNA synthetase (ThrRS), second 'additional' domain {Escherichia coli [TaxId: 562]}
kdeegleiirhscahllghaikqlwphtkmaigpvidngfyydvdldrtltqedvealek
rmhelaeknydvikkkvswhearetfanrgesykvsildeniahddkpglyfheeyvdmc
rgphvpnmrfchhfklmktagaywrgdsnnkmlqriygtawadkkalnaylqrleeaak

Timeline for d1qf6a3:

• d1qf6a3 first appeared (with stable ids) in SCOP 1.55
  
• d1qf6a3 appears in SCOPe 2.07