Lineage for d1qf6a3 (1qf6 A:63-241)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (3 superfamilies) 
Superfamily d.67.1: Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55186] (1 family) 
Family d.67.1.1: Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55187] (1 protein) Protein Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55188] (1 species) Species Escherichia coli [TaxId:562] [55189] (1 PDB entry) 
Domain d1qf6a3: 1qf6 A:63-241 [39562]
Other proteins in same PDB: d1qf6a1, d1qf6a2, d1qf6a4
Details for d1qf6a3
PDB Entry: 1qf6 (more details), 2.9 Å
PDB Description: structure of e. coli threonyl-trna synthetase complexed with its cognate trna
SCOP Domain Sequences for d1qf6a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qf6a3 d.67.1.1 (A:63-241) Threonyl-tRNA synthetase (ThrRS), second 'additional' domain {Escherichia coli}
kdeegleiirhscahllghaikqlwphtkmaigpvidngfyydvdldrtltqedvealek
rmhelaeknydvikkkvswhearetfanrgesykvsildeniahddkpglyfheeyvdmc
rgphvpnmrfchhfklmktagaywrgdsnnkmlqriygtawadkkalnaylqrleeaak
SCOP Domain Coordinates for d1qf6a3:
Click to download the PDB-style file with coordinates for d1qf6a3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qf6a3:
- d1qf6a3 appears in SCOP 1.57
- d1qf6a3 appears in the current release, SCOPe 2.08
View in 3D
