Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6l9nd2: 6l9n D:182-277 [395206] Other proteins in same PDB: d6l9na1, d6l9nb_, d6l9nd1, d6l9ne_, d6l9ng1, d6l9nh_, d6l9nj1, d6l9nk_ automated match to d1kjva1 |
PDB Entry: 6l9n (more details), 2.6 Å
SCOPe Domain Sequences for d6l9nd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l9nd2 b.1.1.0 (D:182-277) automated matches {Human (Homo sapiens) [TaxId: 9606]} tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf qkwasvvvplgkeqnytcrvyheglpepltlrwepp
Timeline for d6l9nd2: