SCOPe 2.08: Domain d6l9ng2: 6l9n G:182-277

Lineage for d6l9ng2 (6l9n G:182-277)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6l9ng2: 6l9n G:182-277 [395120]
   Other proteins in same PDB: d6l9na1, d6l9nb_, d6l9nd1, d6l9ne_, d6l9ng1, d6l9nh_, d6l9nj1, d6l9nk_
   automated match to d1kjva1

Details for d6l9ng2

PDB Entry: 6l9n, 2.6 Å

PDB Description: h2-ld complexed with a5 peptide

PDB Compounds: (G:) MHC

SCOPe Domain Sequences for d6l9ng2:

Sequence; same for both SEQRES and ATOM records:

>d6l9ng2 b.1.1.0 (G:182-277) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwepp

Timeline for d6l9ng2:

• d6l9ng2 first appeared in SCOPe 2.07