Lineage for d6l9ng2 (6l9n G:182-277)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756856Domain d6l9ng2: 6l9n G:182-277 [395120]
    Other proteins in same PDB: d6l9na1, d6l9nb_, d6l9nd1, d6l9ne_, d6l9ng1, d6l9nh_, d6l9nj1, d6l9nk_
    automated match to d1kjva1

Details for d6l9ng2

PDB Entry: 6l9n (more details), 2.6 Å

PDB Description: h2-ld complexed with a5 peptide
PDB Compounds: (G:) MHC

SCOPe Domain Sequences for d6l9ng2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l9ng2 b.1.1.0 (G:182-277) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwepp

SCOPe Domain Coordinates for d6l9ng2:

Click to download the PDB-style file with coordinates for d6l9ng2.
(The format of our PDB-style files is described here.)

Timeline for d6l9ng2: