SCOPe 2.07: Domain d6gepa2: 6gep A:346-425

Lineage for d6gepa2 (6gep A:346-425)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families)
   duplication: contains two subdomains of this fold

5. Family d.58.36.1: Duplicated SiR/NiR-like domains 1 and 3 [55125] (3 proteins)

6. Protein Sulfite reductase, domains 1 and 3 [55126] (1 species)

7. Species Escherichia coli [TaxId:562] [55127] (12 PDB entries)

8. Domain d6gepa2: 6gep A:346-425 [39514]
   Other proteins in same PDB: d6gepa3, d6gepa4
   complexed with k, no, sf4, srm

Details for d6gepa2

PDB Entry: 6gep, 1.8 Å

PDB Description: sulfite reductase hemoprotein nitric oxide complex reduced with proflavine edta

PDB Compounds: (A:) sulfite reductase hemoprotein

SCOPe Domain Sequences for d6gepa2:

Sequence; same for both SEQRES and ATOM records:

>d6gepa2 d.58.36.1 (A:346-425) Sulfite reductase, domains 1 and 3 {Escherichia coli [TaxId: 562]}
igwvkgiddnwhltlfiengrildyparplktglleiakihkgdfritanqnliiagvpe
sekakiekiakesglmnavt

Timeline for d6gepa2:

• d6gepa2 first appeared (with stable ids) in SCOP 1.55, called d6gep_2
  
• d6gepa2 appears in SCOPe 2.06
  
• d6gepa2 appears in the current release, SCOPe 2.08