SCOP 1.55: Domain d6gep_2: 6gep 346-425

Lineage for d6gep_2 (6gep 346-425)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.58: Ferredoxin-like [54861] (36 superfamilies)

4. Superfamily d.58.36: Sulfite reductase, domains 1 and 3 [55124] (1 family)

5. Family d.58.36.1: Sulfite reductase, domains 1 and 3 [55125] (1 protein)

6. Protein Sulfite reductase, domains 1 and 3 [55126] (1 species)

7. Species Escherichia coli [TaxId:562] [55127] (12 PDB entries)

8. Domain d6gep_2: 6gep 346-425 [39514]
   Other proteins in same PDB: d6gep_3, d6gep_4

Details for d6gep_2

PDB Entry: 6gep, 1.8 Å

PDB Description: sulfite reductase hemoprotein nitric oxide complex reduced with proflavine edta

SCOP Domain Sequences for d6gep_2:

Sequence; same for both SEQRES and ATOM records:

>d6gep_2 d.58.36.1 (346-425) Sulfite reductase, domains 1 and 3 {Escherichia coli}
igwvkgiddnwhltlfiengrildyparplktglleiakihkgdfritanqnliiagvpe
sekakiekiakesglmnavt

Timeline for d6gep_2:

• d6gep_2 appears in SCOP 1.57
  
• d6gep_2 appears in the current release, SCOPe 2.08, called d6gepa2