SCOPe 2.08: Domain d1diib1: 1dii B:243-521

Lineage for d1diib1 (1dii B:243-521)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families)
   duplication: contains two subdomains of this fold

5. Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (3 proteins)
   automatically mapped to Pfam PF02913

6. Protein Flavoprotein subunit of p-cresol methylhydroxylase [55107] (1 species)
   the other subunit is a short-chain cytochrome c
7. Species Pseudomonas putida [TaxId:303] [55108] (2 PDB entries)

8. Domain d1diib1: 1dii B:243-521 [39482]
   Other proteins in same PDB: d1diia2, d1diib2, d1diic_, d1diid_
   complexed with cl, fad, hec

Details for d1diib1

PDB Entry: 1dii, 2.5 Å

PDB Description: crystal structure of p-cresol methylhydroxylase at 2.5 a resolution

PDB Compounds: (B:) p-cresol methylhydroxylase

SCOPe Domain Sequences for d1diib1:

Sequence; same for both SEQRES and ATOM records:

>d1diib1 d.58.32.1 (B:243-521) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]}
pvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepg
htpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdt
qpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygl
dyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdr
vaqsygpvkrklehaikravdpnnilapgrsgidlnndf

Timeline for d1diib1:

• d1diib1 first appeared (with stable ids) in SCOP 1.55
  
• d1diib1 appears in SCOPe 2.07