Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) duplication: contains two subdomains of this fold |
Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (3 proteins) automatically mapped to Pfam PF02913 |
Domain d1diib1: 1dii B:243-521 [39482] Other proteins in same PDB: d1diia2, d1diib2, d1diic_, d1diid_ complexed with cl, fad, hec |
PDB Entry: 1dii (more details), 2.5 Å
SCOPe Domain Sequences for d1diib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1diib1 d.58.32.1 (B:243-521) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]} pvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepg htpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdt qpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygl dyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdr vaqsygpvkrklehaikravdpnnilapgrsgidlnndf
Timeline for d1diib1:
View in 3D Domains from other chains: (mouse over for more information) d1diia1, d1diia2, d1diic_, d1diid_ |