| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
| Protein p-Cresol methylhydroxylase, cytochrome c subunit [46669] (1 species) the other subunit is a flavoprotein |
| Species Pseudomonas putida [TaxId:303] [46670] (2 PDB entries) |
| Domain d1diid_: 1dii D: [15926] Other proteins in same PDB: d1diia1, d1diia2, d1diib1, d1diib2 complexed with cl, fad, hec |
PDB Entry: 1dii (more details), 2.5 Å
SCOPe Domain Sequences for d1diid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1diid_ a.3.1.1 (D:) p-Cresol methylhydroxylase, cytochrome c subunit {Pseudomonas putida [TaxId: 303]}
sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
sltqvaeylsslp
Timeline for d1diid_: