Lineage for d1mroe2 (1mro E:2-188)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) 
Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins) 
Protein Beta chain [55099] (3 species) Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (5 PDB entries) 
Domain d1mroe2: 1mro E:2-188 [39450]
Other proteins in same PDB: d1mroa1, d1mroa2, d1mrob1, d1mroc_, d1mrod1, d1mrod2, d1mroe1, d1mrof_
Details for d1mroe2
PDB Entry: 1mro (more details), 1.16 Å
PDB Description: methyl-coenzyme m reductase
SCOP Domain Sequences for d1mroe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mroe2 d.58.31.2 (E:2-188) Beta chain {Archaeon Methanobacterium thermoautotrophicum}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp
SCOP Domain Coordinates for d1mroe2:
Click to download the PDB-style file with coordinates for d1mroe2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mroe2:
View in 3D
