Lineage for d1mroe1 (1mro E:189-443)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily) Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (1 family) 
Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (2 proteins) 
Protein Beta chain [48087] (3 species) Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [48088] (5 PDB entries) 
Domain d1mroe1: 1mro E:189-443 [18532]
Other proteins in same PDB: d1mroa1, d1mroa2, d1mrob2, d1mroc_, d1mrod1, d1mrod2, d1mroe2, d1mrof_
Details for d1mroe1
PDB Entry: 1mro (more details), 1.16 Å
PDB Description: methyl-coenzyme m reductase
SCOP Domain Sequences for d1mroe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mroe1 a.89.1.1 (E:189-443) Beta chain {Archaeon Methanobacterium thermoautotrophicum}
gyalrnimvnhvvaatlkntlqaaalstileqtamfemgdavgafermhllglayqgmna
dnlvfdlvkangkegtvgsviadlveraledgvikvekeltdykvygtddlamwnayaaa
glmaatmvnqgaaraaqgvsstllyyndliefetglpsvdfgkvegtavgfsffshsiyg
gggpgifngnhivtrhskgfaipcvaaamaldagtqmfspeatsglikevfsqvdefrep
lkyvveaaaeiknei
SCOP Domain Coordinates for d1mroe1:
Click to download the PDB-style file with coordinates for d1mroe1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mroe1:
View in 3D
