Lineage for d1mrof_ (1mro F:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80803Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
  5. 80804Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein)
  6. 80805Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 80806Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (5 PDB entries)
  8. 80810Domain d1mrof_: 1mro F: [39438]
    Other proteins in same PDB: d1mroa1, d1mroa2, d1mrob1, d1mrob2, d1mrod1, d1mrod2, d1mroe1, d1mroe2

Details for d1mrof_

PDB Entry: 1mro (more details), 1.16 Å

PDB Description: methyl-coenzyme m reductase

SCOP Domain Sequences for d1mrof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mrof_ d.58.31.1 (F:) Methyl-coenzyme M reductase gamma chain {Archaeon Methanobacterium thermoautotrophicum}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl

SCOP Domain Coordinates for d1mrof_:

Click to download the PDB-style file with coordinates for d1mrof_.
(The format of our PDB-style files is described here.)

Timeline for d1mrof_: