Lineage for d1mroa2 (1mro A:2-269)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 505371Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 505391Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
    C-terminal domain is all-alpha
  6. 505392Protein Alpha chain [55095] (3 species)
  7. 505393Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (5 PDB entries)
  8. 505396Domain d1mroa2: 1mro A:2-269 [39443]
    Other proteins in same PDB: d1mroa1, d1mrob1, d1mrob2, d1mroc_, d1mrod1, d1mroe1, d1mroe2, d1mrof_

Details for d1mroa2

PDB Entry: 1mro (more details), 1.16 Å

PDB Description: methyl-coenzyme m reductase

SCOP Domain Sequences for d1mroa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mroa2 d.58.31.2 (A:2-269) Alpha chain {Archaeon Methanobacterium thermoautotrophicum}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv

SCOP Domain Coordinates for d1mroa2:

Click to download the PDB-style file with coordinates for d1mroa2.
(The format of our PDB-style files is described here.)

Timeline for d1mroa2: