Lineage for d1mroc_ (1mro C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 505371Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 505372Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein)
  6. 505373Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 505374Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (5 PDB entries)
  8. 505377Domain d1mroc_: 1mro C: [39437]
    Other proteins in same PDB: d1mroa1, d1mroa2, d1mrob1, d1mrob2, d1mrod1, d1mrod2, d1mroe1, d1mroe2

Details for d1mroc_

PDB Entry: 1mro (more details), 1.16 Å

PDB Description: methyl-coenzyme m reductase

SCOP Domain Sequences for d1mroc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mroc_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Archaeon Methanobacterium thermoautotrophicum}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl

SCOP Domain Coordinates for d1mroc_:

Click to download the PDB-style file with coordinates for d1mroc_.
(The format of our PDB-style files is described here.)

Timeline for d1mroc_: