Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein) automatically mapped to Pfam PF02240 |
Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species) |
Species Methanopyrus kandleri [TaxId:2320] [55092] (1 PDB entry) |
Domain d1e6vc_: 1e6v C: [39439] Other proteins in same PDB: d1e6va1, d1e6va2, d1e6vb1, d1e6vb2, d1e6vd1, d1e6vd2, d1e6ve1, d1e6ve2 complexed with com, f43, tp7 |
PDB Entry: 1e6v (more details), 2.7 Å
SCOPe Domain Sequences for d1e6vc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6vc_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Methanopyrus kandleri [TaxId: 2320]} fyypgetdvaenrrkymnpnyelkklreipdedivrlmghrepgeeypsvhppleemeep ecpirelveptegakagdriryiqftdsvyfapihpyirarmymwryrgvdtgslsgrqi ievrerdlekiakelleteifdparsgvrgatvhghalrldenglmlhalrryrlneetg eveyvkdqvgieldepipvgapadeddlkerttiyridgtpyredeellqvvqrihelrt lagyrpee
Timeline for d1e6vc_: