Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [193445] (8 species) not a true protein |
Species Arabidopsis thaliana [TaxId:3702] [391060] (3 PDB entries) |
Domain d7bp2d_: 7bp2 D: [394364] automated match to d5gt0d_ complexed with gol, so4 |
PDB Entry: 7bp2 (more details), 1.58 Å
SCOPe Domain Sequences for d7bp2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bp2d_ a.22.1.1 (D:) automated matches {Arabidopsis thaliana [TaxId: 3702]} tykiyifkvlkqvhpdigisskamgimnsfindifeklaqessklarynkkptitsreiq tavrlvlpgelakhavsegtkavtkfts
Timeline for d7bp2d_: