Lineage for d7bp2d_ (7bp2 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2312022Protein automated matches [193445] (8 species)
    not a true protein
  7. 2312053Species Arabidopsis thaliana [TaxId:3702] [391060] (3 PDB entries)
  8. 2312057Domain d7bp2d_: 7bp2 D: [394364]
    automated match to d5gt0d_
    complexed with gol, so4

Details for d7bp2d_

PDB Entry: 7bp2 (more details), 1.58 Å

PDB Description: structural mechanism directing nucleosome reorganization by nap1- related protein 1 (nrp1)
PDB Compounds: (D:) Histone H2B.1

SCOPe Domain Sequences for d7bp2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bp2d_ a.22.1.1 (D:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
tykiyifkvlkqvhpdigisskamgimnsfindifeklaqessklarynkkptitsreiq
tavrlvlpgelakhavsegtkavtkfts

SCOPe Domain Coordinates for d7bp2d_:

Click to download the PDB-style file with coordinates for d7bp2d_.
(The format of our PDB-style files is described here.)

Timeline for d7bp2d_: