Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) common fold is elaborated with additional secondary structures |
Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins) Pfam PF00211 structurally similar to the "palm" domain of DNA/RNA polymerase superfamily |
Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species) |
Species Dog (Canis familiaris) [TaxId:9615] [55078] (15 PDB entries) Uniprot P30803 458-646 |
Domain d1azsa_: 1azs A: [39416] Other proteins in same PDB: d1azsb_, d1azsc1, d1azsc2 complexed with fkp, gsp, mg |
PDB Entry: 1azs (more details), 2.3 Å
SCOPe Domain Sequences for d1azsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1azsa_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris) [TaxId: 9615]} dmmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclri kilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcg vlglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylk ehsietflil
Timeline for d1azsa_: