SCOPe 2.08: Domain d1azsa_: 1azs A:

Lineage for d1azsa_ (1azs A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (3 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
   Pfam PF00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [55078] (15 PDB entries)
   Uniprot P30803 458-646

8. Domain d1azsa_: 1azs A: [39416]
   Other proteins in same PDB: d1azsb_, d1azsc1, d1azsc2
   complexed with fkp, gsp, mg

Details for d1azsa_

PDB Entry: 1azs, 2.3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase

PDB Compounds: (A:) vc1

SCOPe Domain Sequences for d1azsa_:

Sequence; same for both SEQRES and ATOM records:

>d1azsa_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris) [TaxId: 9615]}
dmmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclri
kilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcg
vlglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylk
ehsietflil

Timeline for d1azsa_:

• d1azsa_ first appeared (with stable ids) in SCOP 1.55
  
• d1azsa_ appears in SCOPe 2.07