SCOPe 2.08: Domain d6zljb_: 6zlj B:

Lineage for d6zljb_ (6zlj B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [394075] (2 PDB entries)

8. Domain d6zljb_: 6zlj B: [394108]
   automated match to d1r6da_
   complexed with nad, ugf; mutant

Details for d6zljb_

PDB Entry: 6zlj, 1.7 Å

PDB Description: crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and nad

PDB Compounds: (B:) Epimerase domain-containing protein

SCOPe Domain Sequences for d6zljb_:

Sequence; same for both SEQRES and ATOM records:

>d6zljb_ c.2.1.0 (B:) automated matches {Bacillus cereus [TaxId: 1396]}
mkilvtgaagfigshlcqallknsayhvvgidhfigptpatlktgniqslelnsrfqfir
edilntdlskllqdidvvyhlaaipgvrtswgkdfqpyvtnnimvtqqlleackhikldk
fihistssvygeksgavsedllpiplspfgvtklsgehlchvyhknfhipivilryftvy
gprqrpdmafhrlikqmledkpltifgdgtqtrdftyiddcirgtvaaletkkniigevi
niggkeqasildiismlekisgksatknflksvpgepkqtwadiskastllqysptvsls
dgleaeydyikqly

Timeline for d6zljb_:

• d6zljb_ first appeared in SCOPe 2.07