| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.22: TRADD, N-terminal domain [55044] (1 family) ![]() |
| Family d.58.22.1: TRADD, N-terminal domain [55045] (1 protein) |
| Protein TRADD, N-terminal domain [55046] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55047] (2 PDB entries) |
| Domain d1f3va_: 1f3v A: [39382] Other proteins in same PDB: d1f3vb1, d1f3vb2 |
PDB Entry: 1f3v (more details), 2 Å
SCOPe Domain Sequences for d1f3va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3va_ d.58.22.1 (A:) TRADD, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
heewvgsaylfvessldkvvlsdayahpqqkvavyralqaalaesggspdvlqmlkihrs
dpqlivqlrfcgrqpcgrflrayregalraalqrslaaalaqhsvplqlelragaerlda
lladeerclscilaqqpdrlrdeelaeledalrnlkcg
Timeline for d1f3va_: