SCOPe 2.06: Domain d1f3va_: 1f3v A:

Lineage for d1f3va_ (1f3v A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.22: TRADD, N-terminal domain [55044] (1 family)

5. Family d.58.22.1: TRADD, N-terminal domain [55045] (1 protein)

6. Protein TRADD, N-terminal domain [55046] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55047] (2 PDB entries)

8. Domain d1f3va_: 1f3v A: [39382]
   Other proteins in same PDB: d1f3vb1, d1f3vb2

Details for d1f3va_

PDB Entry: 1f3v, 2 Å

PDB Description: crystal structure of the complex between the n-terminal domain of tradd and the traf domain of traf2

PDB Compounds: (A:) tumor necrosis factor receptor type 1 associated death domain protein

SCOPe Domain Sequences for d1f3va_:

Sequence; same for both SEQRES and ATOM records:

>d1f3va_ d.58.22.1 (A:) TRADD, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
heewvgsaylfvessldkvvlsdayahpqqkvavyralqaalaesggspdvlqmlkihrs
dpqlivqlrfcgrqpcgrflrayregalraalqrslaaalaqhsvplqlelragaerlda
lladeerclscilaqqpdrlrdeelaeledalrnlkcg

Timeline for d1f3va_:

• d1f3va_ first appeared (with stable ids) in SCOP 1.55
  
• d1f3va_ appears in SCOPe 2.05
  
• d1f3va_ appears in SCOPe 2.07
  
• d1f3va_ appears in the current release, SCOPe 2.08