Lineage for d6xr5f1 (6xr5 F:1-191)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2930983Species Cryptococcus neoformans [TaxId:235443] [393418] (1 PDB entry)
  8. 2930989Domain d6xr5f1: 6xr5 F:1-191 [393441]
    Other proteins in same PDB: d6xr5a2, d6xr5a3, d6xr5b2, d6xr5b3, d6xr5c2, d6xr5c3, d6xr5d2, d6xr5d3, d6xr5e2, d6xr5f2, d6xr5g2, d6xr5h2, d6xr5h3
    automated match to d3f0na1
    complexed with ade, edo, so4

Details for d6xr5f1

PDB Entry: 6xr5 (more details), 1.7 Å

PDB Description: crystal structure of diphosphomevalonate decarboxylase (mvd1) cryptococcus neoformans var. grubii serotype a
PDB Compounds: (F:) Diphosphomevalonate decarboxylase

SCOPe Domain Sequences for d6xr5f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xr5f1 d.14.1.0 (F:1-191) automated matches {Cryptococcus neoformans [TaxId: 235443]}
mvheatasapvniacikywgkrdtrlilptnsslsvtldqdhlrstttsradasfeagdr
lwlngreeaikeggrlavcikelrawrkemetkdknlpklsewplriasynnfptaagla
ssasglaalvaslaslyslpqspsqlslvarqgsgsacrslfggfvawregtdpagsdsl
aeevaprehwp

SCOPe Domain Coordinates for d6xr5f1:

Click to download the PDB-style file with coordinates for d6xr5f1.
(The format of our PDB-style files is described here.)

Timeline for d6xr5f1: