Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
Protein automated matches [190826] (23 species) not a true protein |
Species Cryptococcus neoformans [TaxId:235443] [393418] (1 PDB entry) |
Domain d6xr5e1: 6xr5 E:1-191 [393437] Other proteins in same PDB: d6xr5a2, d6xr5a3, d6xr5b2, d6xr5b3, d6xr5c2, d6xr5c3, d6xr5d2, d6xr5d3, d6xr5e2, d6xr5f2, d6xr5g2, d6xr5h2, d6xr5h3 automated match to d3f0na1 complexed with ade, edo, so4 |
PDB Entry: 6xr5 (more details), 1.7 Å
SCOPe Domain Sequences for d6xr5e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xr5e1 d.14.1.0 (E:1-191) automated matches {Cryptococcus neoformans [TaxId: 235443]} mvheatasapvniacikywgkrdtrlilptnsslsvtldqdhlrstttsradasfeagdr lwlngreeaikeggrlavcikelrawrkemetkdknlpklsewplriasynnfptaagla ssasglaalvaslaslyslpqspsqlslvarqgsgsacrslfggfvawregtdpagsdsl aeevaprehwp
Timeline for d6xr5e1: