Lineage for d1cqmb_ (1cqm B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1028924Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1028925Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1028926Protein Ribosomal protein S6 [54997] (4 species)
  7. 1028956Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 1029008Domain d1cqmb_: 1cqm B: [39322]
    mutant engineered for aggregation

Details for d1cqmb_

PDB Entry: 1cqm (more details), 1.65 Å

PDB Description: protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.
PDB Compounds: (B:) ribosomal protein s6

SCOPe Domain Sequences for d1cqmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqmb_ d.58.14.1 (B:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepfl

SCOPe Domain Coordinates for d1cqmb_:

Click to download the PDB-style file with coordinates for d1cqmb_.
(The format of our PDB-style files is described here.)

Timeline for d1cqmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cqma_