SCOPe 2.01: Domain d1cqma_: 1cqm A:

Lineage for d1cqma_ (1cqm A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family)

5. Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)

6. Protein Ribosomal protein S6 [54997] (4 species)

7. Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
   Uniprot P23370

8. Domain d1cqma_: 1cqm A: [39321]
   mutant engineered for aggregation

Details for d1cqma_

PDB Entry: 1cqm, 1.65 Å

PDB Description: protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.

PDB Compounds: (A:) ribosomal protein s6

SCOPe Domain Sequences for d1cqma_:

Sequence; same for both SEQRES and ATOM records:

>d1cqma_ d.58.14.1 (A:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepfl

Timeline for d1cqma_:

• d1cqma_ first appeared (with stable ids) in SCOP 1.55
  
• d1cqma_ appears in SCOP 1.75
  
• d1cqma_ appears in SCOPe 2.02
  
• d1cqma_ appears in the current release, SCOPe 2.08