Lineage for d1hnwf_ (1hnw F:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80538Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 80539Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 80540Protein Ribosomal protein S6 [54997] (1 species)
  7. 80541Species Thermus thermophilus [TaxId:274] [54998] (16 PDB entries)
  8. 80549Domain d1hnwf_: 1hnw F: [39319]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwf_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwf_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOP Domain Coordinates for d1hnwf_:

Click to download the PDB-style file with coordinates for d1hnwf_.
(The format of our PDB-style files is described here.)

Timeline for d1hnwf_: