SCOP 1.57: Domain d1hnwp_: 1hnw P:

Lineage for d1hnwp_ (1hnw P:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)

4. Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family)

5. Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)

6. Protein Ribosomal protein S16 [54567] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54568] (11 PDB entries)

8. Domain d1hnwp_: 1hnw P: [38447]
   Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwp_

PDB Entry: 1hnw, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwp_:

Sequence; same for both SEQRES and ATOM records:

>d1hnwp_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqearega

Timeline for d1hnwp_:

• d1hnwp_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnwp_ appears in SCOP 1.59
  
• d1hnwp_ appears in the current release, SCOPe 2.08