Lineage for d1fnma5 (1fnm A:600-688)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504884Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) (S)
  5. 504885Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 504896Protein Elongation factor G (EF-G) [54982] (1 species)
    domain III is seen in 1FNM but disordered in the most of other PDB entries
  7. 504897Species Thermus thermophilus [TaxId:274] [54983] (6 PDB entries)
  8. 504901Domain d1fnma5: 1fnm A:600-688 [39303]
    Other proteins in same PDB: d1fnma1, d1fnma2, d1fnma3

Details for d1fnma5

PDB Entry: 1fnm (more details), 2.8 Å

PDB Description: structure of thermus thermophilus ef-g h573a

SCOP Domain Sequences for d1fnma5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnma5 d.58.11.1 (A:600-688) Elongation factor G (EF-G) {Thermus thermophilus}
vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl
rsktqgrgsfvmffdhyqevpkqvqekli

SCOP Domain Coordinates for d1fnma5:

Click to download the PDB-style file with coordinates for d1fnma5.
(The format of our PDB-style files is described here.)

Timeline for d1fnma5: