Lineage for d1dara4 (1dar A:600-689)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196480Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2196481Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 2196537Protein Elongation factor G (EF-G) [54982] (2 species)
    domain III is seen in 1FNM but disordered in the most of other PDB entries
  7. 2196538Species Thermus thermophilus [TaxId:274] [54983] (9 PDB entries)
  8. 2196543Domain d1dara4: 1dar A:600-689 [39300]
    Other proteins in same PDB: d1dara1, d1dara2, d1dara3
    complexed with gdp

Details for d1dara4

PDB Entry: 1dar (more details), 2.4 Å

PDB Description: elongation factor g in complex with gdp
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d1dara4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dara4 d.58.11.1 (A:600-689) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]}
vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl
rsktqgrgsfvmffdhyqevpkqvqeklik

SCOPe Domain Coordinates for d1dara4:

Click to download the PDB-style file with coordinates for d1dara4.
(The format of our PDB-style files is described here.)

Timeline for d1dara4: