![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) ![]() |
![]() | Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
![]() | Protein Elongation factor G (EF-G) [54982] (2 species) domain III is seen in 1FNM but disordered in the most of other PDB entries |
![]() | Species Thermus thermophilus [TaxId:274] [54983] (9 PDB entries) |
![]() | Domain d1dara4: 1dar A:600-689 [39300] Other proteins in same PDB: d1dara1, d1dara2, d1dara3 complexed with gdp |
PDB Entry: 1dar (more details), 2.4 Å
SCOPe Domain Sequences for d1dara4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dara4 d.58.11.1 (A:600-689) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl rsktqgrgsfvmffdhyqevpkqvqeklik
Timeline for d1dara4: