PDB entry 1dar

View 1dar on RCSB PDB site
Description: elongation factor g in complex with GDP
Class: translational gtpase
Keywords: ribosomal translocase, translational gtpase
Deposited on 1996-02-15, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor G
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dara1, d1dara2, d1dara3, d1dara4
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1darA (A:)
    mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqere
    rgititaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqset
    vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
    lrmkaytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeeptee
    elvaairkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevve
    ihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmha
    nhreeveelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkad
    qeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpq
    vayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyip
    avqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpv
    ilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlr
    sktqgrgsfvmffdhyqevpkqvqeklikgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1darA (A:)
    mavkveydlkrlrnigiaahidagktttterilyytgriaavttcfwkdhriniidtpgh
    vdftieversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlw
    lvirtmqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyld
    qareyheklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknk
    gvqllldavvdylpspldippikgttpegevveihpdpngplaalafkimadpyvgrltf
    irvysgtltsgsyvynttkgrkervarllrmhanhreeveelkagdlgavvglketitgd
    tlvgedaprvileseedptfrvsthqtiisgmgellkrefkvdanvgkpqvayretitkp
    vdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyipavqkgieeam
    qsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpvilepimrvev
    ttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlrsktqgrgsfv
    mffdhyqevpkqvqeklik