Lineage for d1apsa_ (1aps A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196354Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) (S)
  5. 2196355Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins)
    automatically mapped to Pfam PF00708
  6. 2196356Protein Acylphosphatase [54977] (4 species)
  7. 2196359Species Horse (Equus caballus) [TaxId:9796] [54979] (1 PDB entry)
  8. 2196360Domain d1apsa_: 1aps A: [39299]

Details for d1apsa_

PDB Entry: 1aps (more details)

PDB Description: three-dimensional structure of acylphosphatase. refinement and structure analysis
PDB Compounds: (A:) acylphosphatase

SCOPe Domain Sequences for d1apsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apsa_ d.58.10.1 (A:) Acylphosphatase {Horse (Equus caballus) [TaxId: 9796]}
starplksvdyevfgrvqgvcfrmyaedearkigvvgwvkntskgtvtgqvqgpeekvns
mkswlskvgspssridrtnfsnektiskleysnfsvry

SCOPe Domain Coordinates for d1apsa_:

Click to download the PDB-style file with coordinates for d1apsa_.
(The format of our PDB-style files is described here.)

Timeline for d1apsa_: