![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) ![]() |
![]() | Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins) automatically mapped to Pfam PF00708 |
![]() | Protein Acylphosphatase [54977] (4 species) |
![]() | Species Horse (Equus caballus) [TaxId:9796] [54979] (1 PDB entry) |
![]() | Domain d1apsa_: 1aps A: [39299] |
PDB Entry: 1aps (more details)
SCOPe Domain Sequences for d1apsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1apsa_ d.58.10.1 (A:) Acylphosphatase {Horse (Equus caballus) [TaxId: 9796]} starplksvdyevfgrvqgvcfrmyaedearkigvvgwvkntskgtvtgqvqgpeekvns mkswlskvgspssridrtnfsnektiskleysnfsvry
Timeline for d1apsa_: