Lineage for d6voof2 (6voo F:98-377)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2477556Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2478123Protein automated matches [190393] (13 species)
    not a true protein
  7. 2478241Species Spinacia oleracea [TaxId:3562] [352463] (2 PDB entries)
  8. 2478244Domain d6voof2: 6voo F:98-377 [392822]
    Other proteins in same PDB: d6vooa1, d6vooa2, d6vooa3, d6voob1, d6voob2, d6voob3, d6vooc1, d6vooc2, d6vooc3, d6vood1, d6vood3, d6vooe1, d6vooe3, d6voof1, d6voof3
    automated match to d2qe7d2
    complexed with adp, atp, ttx

Details for d6voof2

PDB Entry: 6voo (more details), 3.05 Å

PDB Description: chloroplast atp synthase (r1, cf1)
PDB Compounds: (F:) ATP synthase subunit beta, chloroplastic

SCOPe Domain Sequences for d6voof2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6voof2 c.37.1.11 (F:98-377) automated matches {Spinacia oleracea [TaxId: 3562]}
lsvpvggatlgrifnvlgepvdnlgpvdtrttspihrsapaftqldtklsifetgikvvd
llapyrrggkiglfggagvgktvlimelinniakahggvsvfggvgertregndlymemk
esgvineqniaeskvalvygqmneppgarmrvgltaltmaeyfrdvneqdvllfidnifr
fvqagsevsallgrmpsavgyqptlstemgslqeritstkegsitsiqavyvpaddltdp
apattfahldattvlsrglaakgiypavdpldststmlqp

SCOPe Domain Coordinates for d6voof2:

Click to download the PDB-style file with coordinates for d6voof2.
(The format of our PDB-style files is described here.)

Timeline for d6voof2: