SCOP 1.63: Domain d1rcoo2: 1rco O:9-147

Lineage for d1rcoo2 (1rco O:9-147)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)

8. Domain d1rcoo2: 1rco O:9-147 [39267]
   Other proteins in same PDB: d1rcob1, d1rcoc_, d1rcoe1, d1rcof_, d1rcoh1, d1rcoi_, d1rcok1, d1rcol1, d1rcom_, d1rcoo1, d1rcop_, d1rcor1, d1rcos_, d1rcot_, d1rcov1, d1rcow_

Details for d1rcoo2

PDB Entry: 1rco, 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor d-xylulose-2,2-diol-1,5-bisphosphate

SCOP Domain Sequences for d1rcoo2:

Sequence; same for both SEQRES and ATOM records:

>d1rcoo2 d.58.9.1 (O:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

Timeline for d1rcoo2:

• d1rcoo2 first appeared (with stable ids) in SCOP 1.55
  
• d1rcoo2 appears in SCOP 1.61
  
• d1rcoo2 appears in SCOP 1.65
  
• d1rcoo2 appears in the current release, SCOPe 2.08