Lineage for d1rbol2 (1rbo L:9-147)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80425Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 80426Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 80427Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species)
  7. 80449Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)
  8. 80461Domain d1rbol2: 1rbo L:9-147 [39249]
    Other proteins in same PDB: d1rbob1, d1rboc_, d1rboe1, d1rbof_, d1rboh1, d1rboi_, d1rbol1, d1rbos_

Details for d1rbol2

PDB Entry: 1rbo (more details), 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor 2-carboxyarabinitol-1,5- diphosphate

SCOP Domain Sequences for d1rbol2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rbol2 d.58.9.1 (L:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

SCOP Domain Coordinates for d1rbol2:

Click to download the PDB-style file with coordinates for d1rbol2.
(The format of our PDB-style files is described here.)

Timeline for d1rbol2: