SCOP 1.55: Domain d1rbol2: 1rbo L:9-147

Lineage for d1rbol2 (1rbo L:9-147)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.58: Ferredoxin-like [54861] (36 superfamilies)

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries)

8. Domain d1rbol2: 1rbo L:9-147 [39249]
   Other proteins in same PDB: d1rbob1, d1rboc_, d1rboe1, d1rbof_, d1rboh1, d1rboi_, d1rbol1, d1rbos_

Details for d1rbol2

PDB Entry: 1rbo, 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor 2-carboxyarabinitol-1,5- diphosphate

SCOP Domain Sequences for d1rbol2:

Sequence; same for both SEQRES and ATOM records:

>d1rbol2 d.58.9.1 (L:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

Timeline for d1rbol2:

• d1rbol2 appears in SCOP 1.57
  
• d1rbol2 appears in the current release, SCOPe 2.08