| Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
| Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) ![]() |
| Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
| Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (6 species) |
| Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries) |
| Domain d1rboe2: 1rbo E:9-147 [39251] Other proteins in same PDB: d1rbob1, d1rboc_, d1rboe1, d1rbof_, d1rboh1, d1rboi_, d1rbol1, d1rbos_ |
PDB Entry: 1rbo (more details), 2.3 Å
SCOP Domain Sequences for d1rboe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rboe2 d.58.9.1 (E:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt
Timeline for d1rboe2: