Lineage for d6urac2 (6ura C:152-463)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2447081Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2447553Family c.1.14.0: automated matches [227297] (1 protein)
    not a true family
  6. 2447554Protein automated matches [227123] (9 species)
    not a true protein
  7. 2447568Species Candidatus promineofilum [TaxId:1806508] [392409] (1 PDB entry)
  8. 2447571Domain d6urac2: 6ura C:152-463 [392415]
    Other proteins in same PDB: d6uraa1, d6urab1, d6urac1, d6urad1
    automated match to d4ruba1
    complexed with cap, mg

Details for d6urac2

PDB Entry: 6ura (more details), 2.17 Å

PDB Description: crystal structure of rubisco from promineofilum breve
PDB Compounds: (C:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d6urac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6urac2 c.1.14.0 (C:152-463) automated matches {Candidatus promineofilum [TaxId: 1806508]}
fpgprvgiydervwsnkwdrpliggtvkpklglspkaystiiyeclsggldtskddenmn
sqpfsrwrdrfmyaqeavdraaaetnefkghwhnvtagsteeslrrleyayelgsrmvmf
dfltagfaasadifkrageldmivhchramhavftrqanhgiamrvvakwlrltggdhlh
tgtvvgklegswndtlgiidilreryvkanlehglyfdqdfgglkaswpvasggihvhhv
pdllkiygndafflfgggthghpdgsragaianraaveavsagqtlqqaarscpelrksl
elwadvkfevvq

SCOPe Domain Coordinates for d6urac2:

Click to download the PDB-style file with coordinates for d6urac2.
(The format of our PDB-style files is described here.)

Timeline for d6urac2: