Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) automatically mapped to Pfam PF00016 |
Family c.1.14.0: automated matches [227297] (1 protein) not a true family |
Protein automated matches [227123] (9 species) not a true protein |
Species Candidatus promineofilum [TaxId:1806508] [392409] (1 PDB entry) |
Domain d6urac2: 6ura C:152-463 [392415] Other proteins in same PDB: d6uraa1, d6urab1, d6urac1, d6urad1 automated match to d4ruba1 complexed with cap, mg |
PDB Entry: 6ura (more details), 2.17 Å
SCOPe Domain Sequences for d6urac2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6urac2 c.1.14.0 (C:152-463) automated matches {Candidatus promineofilum [TaxId: 1806508]} fpgprvgiydervwsnkwdrpliggtvkpklglspkaystiiyeclsggldtskddenmn sqpfsrwrdrfmyaqeavdraaaetnefkghwhnvtagsteeslrrleyayelgsrmvmf dfltagfaasadifkrageldmivhchramhavftrqanhgiamrvvakwlrltggdhlh tgtvvgklegswndtlgiidilreryvkanlehglyfdqdfgglkaswpvasggihvhhv pdllkiygndafflfgggthghpdgsragaianraaveavsagqtlqqaarscpelrksl elwadvkfevvq
Timeline for d6urac2: