SCOPe 2.07: Domain d6urab2: 6ura B:152-463

Lineage for d6urab2 (6ura B:152-463)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
   automatically mapped to Pfam PF00016

5. Family c.1.14.0: automated matches [227297] (1 protein)
   not a true family

6. Protein automated matches [227123] (9 species)
   not a true protein

7. Species Candidatus promineofilum [TaxId:1806508] [392409] (1 PDB entry)

8. Domain d6urab2: 6ura B:152-463 [392436]
   Other proteins in same PDB: d6uraa1, d6urab1, d6urac1, d6urad1
   automated match to d4ruba1
   complexed with cap, mg

Details for d6urab2

PDB Entry: 6ura, 2.17 Å

PDB Description: crystal structure of rubisco from promineofilum breve

PDB Compounds: (B:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d6urab2:

Sequence; same for both SEQRES and ATOM records:

>d6urab2 c.1.14.0 (B:152-463) automated matches {Candidatus promineofilum [TaxId: 1806508]}
fpgprvgiydervwsnkwdrpliggtvkpklglspkaystiiyeclsggldtskddenmn
sqpfsrwrdrfmyaqeavdraaaetnefkghwhnvtagsteeslrrleyayelgsrmvmf
dfltagfaasadifkrageldmivhchramhavftrqanhgiamrvvakwlrltggdhlh
tgtvvgklegswndtlgiidilreryvkanlehglyfdqdfgglkaswpvasggihvhhv
pdllkiygndafflfgggthghpdgsragaianraaveavsagqtlqqaarscpelrksl
elwadvkfevvq

Timeline for d6urab2:

• d6urab2 is new in SCOPe 2.07-stable
  
• d6urab2 appears in the current release, SCOPe 2.08