Lineage for d1b3ta_ (1b3t A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) 
Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins) Protein Epstein barr virus nuclear antigen-1 (ebna1) [54964] (2 species)
DNA-binding mode differs from that of E2 protein
Species Epstein-Barr virus [TaxId:10376] [54965] (2 PDB entries) 
Domain d1b3ta_: 1b3t A: [39228]
protein/DNA complex
has additional insertions and/or extensions that are not grouped together
Details for d1b3ta_
PDB Entry: 1b3t (more details), 2.2 Å
PDB Description: ebna-1 nuclear protein/dna complex
PDB Compounds: (A:) protein (nuclear protein ebna1)SCOPe Domain Sequences for d1b3ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b3ta_ d.58.8.1 (A:) Epstein barr virus nuclear antigen-1 (ebna1) {Epstein-Barr virus [TaxId: 10376]}
kggwfgkhrgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynl
rrgtalaipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaik
dlvmtkpaptcnirvtvcsfddgvdlp
SCOPe Domain Coordinates for d1b3ta_:
Click to download the PDB-style file with coordinates for d1b3ta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b3ta_:
- d1b3ta_ first appeared (with stable ids) in SCOP 1.55
- d1b3ta_ appears in SCOPe 2.07
View in 3D
