SCOPe 2.07: Domain d6twhe1: 6twh E:1-320

Lineage for d6twhe1 (6twh E:1-320)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (57 species)
   not a true protein

7. Species Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId:1572188] [391916] (10 PDB entries)

8. Domain d6twhe1: 6twh E:1-320 [392136]
   Other proteins in same PDB: d6twha2, d6twhb_, d6twhc2, d6twhd_, d6twhe2, d6twhf_, d6twhl2, d6twhm_, d6twhn2, d6twho_, d6twhp2, d6twhq_
   automated match to d3ztna_
   complexed with ca, nag; mutant

Details for d6twhe1

PDB Entry: 6twh, 2.68 Å

PDB Description: crystal structure of the haemagglutinin mutant (gln226leu, gly228ser) from an h10n7 seal influenza virus isolated in germany

PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d6twhe1:

Sequence; same for both SEQRES and ATOM records:

>d6twhe1 b.19.1.0 (E:1-320) automated matches {Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId: 1572188]}
dkiclghhavangtivktltneqeevtnatetvestslnrlcmkgrnhkdlgnchpigml
igtpacdlhltgtwdtlierknaiaycypgatvneealrqkimesggiskintgftygss
insagttkacmrnggnsfyaelkwlvsknkgqnfpqttntyrnadtaehlimwgihhpss
tqekndlygtqslsisvgsstyknnfvpvvgarpqvnglssridfhwtlvqpgdkitfsh
nggliapsrvskligrglgiqseapidnsceskcfwrggsintrlpfqnlsprtvgqcpk
yvnkkslmlatgmrnvpelv

Timeline for d6twhe1:

• d6twhe1 is new in SCOPe 2.07-stable
  
• d6twhe1 appears in the current release, SCOPe 2.08