SCOPe 2.06: Domain d1g2ea2: 1g2e A:119-203

Lineage for d1g2ea2 (1g2e A:119-203)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Hu antigen D (Hud) [54942] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54943] (2 PDB entries)

8. Domain d1g2ea2: 1g2e A:119-203 [39186]
   protein/RNA complex

Details for d1g2ea2

PDB Entry: 1g2e, 2.3 Å

PDB Description: crystal structure of hud and au-rich element of the tumor necrosis factor alpha rna

PDB Compounds: (A:) paraneoplastic encephalomyelitis antigen hud

SCOPe Domain Sequences for d1g2ea2:

Sequence; same for both SEQRES and ATOM records:

>d1g2ea2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}
sasirdanlyvsglpktmtqkeleqlfsqygriitsrilvdqvtgvsrgvgfirfdkrie
aeeaikglngqkpsgatepitvkfa

Timeline for d1g2ea2:

• d1g2ea2 first appeared (with stable ids) in SCOP 1.55
  
• d1g2ea2 appears in SCOPe 2.05
  
• d1g2ea2 appears in SCOPe 2.07
  
• d1g2ea2 appears in the current release, SCOPe 2.08