Lineage for d1g2ea2 (1g2e A:119-203)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32639Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families) (S)
  5. 32640Family d.58.7.1: Canonical RBD [54929] (12 proteins)
  6. 32649Protein Hu antigen D (Hud) [54942] (1 species)
  7. 32650Species Human (Homo sapiens) [TaxId:9606] [54943] (2 PDB entries)
  8. 32654Domain d1g2ea2: 1g2e A:119-203 [39186]

Details for d1g2ea2

PDB Entry: 1g2e (more details), 2.3 Å

PDB Description: crystal structure of hud and au-rich element of the tumor necrosis factor alpha rna

SCOP Domain Sequences for d1g2ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2ea2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens)}
sasirdanlyvsglpktmtqkeleqlfsqygriitsrilvdqvtgvsrgvgfirfdkrie
aeeaikglngqkpsgatepitvkfa

SCOP Domain Coordinates for d1g2ea2:

Click to download the PDB-style file with coordinates for d1g2ea2.
(The format of our PDB-style files is described here.)

Timeline for d1g2ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g2ea1