SCOPe 2.08: Domain d6t5da_: 6t5d A:

Lineage for d6t5da_ (6t5d A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species Norwalk virus [TaxId:37129] [311216] (22 PDB entries)

8. Domain d6t5da_: 6t5d A: [391800]
   automated match to d2ipha_
   complexed with mjw

Details for d6t5da_

PDB Entry: 6t5d, 1.42 Å

PDB Description: 3c-like protease from southampton virus complexed with fmopl000014a.

PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d6t5da_:

Sequence; same for both SEQRES and ATOM records:

>d6t5da_ b.47.1.4 (A:) automated matches {Norwalk virus [TaxId: 37129]}
apptlwsrvtkfgsgwgfwvsptvfittthviptsakeffgepltsiaihrageftlfrf
skkirpdltgmileegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lltganakgmdlgtipgdcgapyvykrandwvvcgvhaaatksgntvvcavq

Timeline for d6t5da_:

• d6t5da_ first appeared in SCOPe 2.07