Lineage for d6t5da_ (6t5d A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797935Protein automated matches [190384] (21 species)
    not a true protein
  7. 2798057Species Norwalk virus [TaxId:37129] [311216] (22 PDB entries)
  8. 2798062Domain d6t5da_: 6t5d A: [391800]
    automated match to d2ipha_
    complexed with mjw

Details for d6t5da_

PDB Entry: 6t5d (more details), 1.42 Å

PDB Description: 3c-like protease from southampton virus complexed with fmopl000014a.
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d6t5da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t5da_ b.47.1.4 (A:) automated matches {Norwalk virus [TaxId: 37129]}
apptlwsrvtkfgsgwgfwvsptvfittthviptsakeffgepltsiaihrageftlfrf
skkirpdltgmileegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lltganakgmdlgtipgdcgapyvykrandwvvcgvhaaatksgntvvcavq

SCOPe Domain Coordinates for d6t5da_:

Click to download the PDB-style file with coordinates for d6t5da_.
(The format of our PDB-style files is described here.)

Timeline for d6t5da_: